Icon representing a puzzle

2540: Revisiting Puzzle 83: Cardiotoxin

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
November 27, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Andrew's Foldit group 11. Andrew's Foldit group 1 pt. 7,247
  2. Avatar for CBME5920_2022 12. CBME5920_2022 1 pt. 7,178
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 7,110
  4. Avatar for Coastal Biochemistry 14. Coastal Biochemistry 1 pt. 0
  1. Avatar for Larini 41. Larini Lv 1 3 pts. 8,772
  2. Avatar for jamiexq 42. jamiexq Lv 1 3 pts. 8,755
  3. Avatar for abiogenesis 43. abiogenesis Lv 1 2 pts. 8,724
  4. Avatar for carxo 44. carxo Lv 1 2 pts. 8,562
  5. Avatar for Trajan464 45. Trajan464 Lv 1 2 pts. 8,521
  6. Avatar for Crossed Sticks 46. Crossed Sticks Lv 1 2 pts. 8,314
  7. Avatar for DScott 47. DScott Lv 1 2 pts. 8,251
  8. Avatar for zbp 48. zbp Lv 1 1 pt. 8,235
  9. Avatar for RWoodcock 49. RWoodcock Lv 1 1 pt. 8,168
  10. Avatar for Mohoernchen 50. Mohoernchen Lv 1 1 pt. 8,104

Comments