Icon representing a puzzle

2540: Revisiting Puzzle 83: Cardiotoxin

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
November 27, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,416
  2. Avatar for Go Science 2. Go Science 68 pts. 10,382
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 10,230
  4. Avatar for Contenders 4. Contenders 27 pts. 10,166
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 10,157
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 10,099
  7. Avatar for Void Crushers 7. Void Crushers 5 pts. 10,030
  8. Avatar for VeFold 8. VeFold 3 pts. 9,930
  9. Avatar for Australia 9. Australia 1 pt. 9,631
  10. Avatar for Team China 10. Team China 1 pt. 7,326
  1. Avatar for Larini 41. Larini Lv 1 3 pts. 8,772
  2. Avatar for jamiexq 42. jamiexq Lv 1 3 pts. 8,755
  3. Avatar for abiogenesis 43. abiogenesis Lv 1 2 pts. 8,724
  4. Avatar for carxo 44. carxo Lv 1 2 pts. 8,562
  5. Avatar for Trajan464 45. Trajan464 Lv 1 2 pts. 8,521
  6. Avatar for Crossed Sticks 46. Crossed Sticks Lv 1 2 pts. 8,314
  7. Avatar for DScott 47. DScott Lv 1 2 pts. 8,251
  8. Avatar for zbp 48. zbp Lv 1 1 pt. 8,235
  9. Avatar for RWoodcock 49. RWoodcock Lv 1 1 pt. 8,168
  10. Avatar for Mohoernchen 50. Mohoernchen Lv 1 1 pt. 8,104

Comments