Icon representing a puzzle

2540: Revisiting Puzzle 83: Cardiotoxin

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
November 27, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,416
  2. Avatar for Go Science 2. Go Science 68 pts. 10,382
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 10,230
  4. Avatar for Contenders 4. Contenders 27 pts. 10,166
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 10,157
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 10,099
  7. Avatar for Void Crushers 7. Void Crushers 5 pts. 10,030
  8. Avatar for VeFold 8. VeFold 3 pts. 9,930
  9. Avatar for Australia 9. Australia 1 pt. 9,631
  10. Avatar for Team China 10. Team China 1 pt. 7,326

  1. Avatar for nastya 71. nastya Lv 1 1 pt. 6,974
  2. Avatar for lepoto 72. lepoto Lv 1 1 pt. 6,920
  3. Avatar for Lexeqtor 73. Lexeqtor Lv 1 1 pt. 6,886
  4. Avatar for Kineticcat_ 74. Kineticcat_ Lv 1 1 pt. 6,672
  5. Avatar for kandkkevin 75. kandkkevin Lv 1 1 pt. 984
  6. Avatar for accisner 76. accisner Lv 1 1 pt. 581
  7. Avatar for Arc_Dandy 77. Arc_Dandy Lv 1 1 pt. 0
  8. Avatar for rgthomy 78. rgthomy Lv 1 1 pt. 0

Comments