Icon representing a puzzle

2540: Revisiting Puzzle 83: Cardiotoxin

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
November 27, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,416
  2. Avatar for Go Science 2. Go Science 68 pts. 10,382
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 10,230
  4. Avatar for Contenders 4. Contenders 27 pts. 10,166
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 10,157
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 10,099
  7. Avatar for Void Crushers 7. Void Crushers 5 pts. 10,030
  8. Avatar for VeFold 8. VeFold 3 pts. 9,930
  9. Avatar for Australia 9. Australia 1 pt. 9,631
  10. Avatar for Team China 10. Team China 1 pt. 7,326
  1. Avatar for JuliaBCollet 31. JuliaBCollet Lv 1 9 pts. 9,451
  2. Avatar for Anfinsen_slept_here 32. Anfinsen_slept_here Lv 1 8 pts. 9,414
  3. Avatar for nicobul 33. nicobul Lv 1 7 pts. 9,413
  4. Avatar for Th1sN@me!sN0tAPun 34. Th1sN@me!sN0tAPun Lv 1 7 pts. 9,347
  5. Avatar for Hellcat6 35. Hellcat6 Lv 1 6 pts. 9,329
  6. Avatar for stomjoh 36. stomjoh Lv 1 5 pts. 9,268
  7. Avatar for AlphaFold2 37. AlphaFold2 Lv 1 5 pts. 9,115
  8. Avatar for Dr.Sillem 38. Dr.Sillem Lv 1 4 pts. 9,112
  9. Avatar for Alistair69 39. Alistair69 Lv 1 4 pts. 8,937
  10. Avatar for drumpeter18yrs9yrs 40. drumpeter18yrs9yrs Lv 1 3 pts. 8,791

Comments