Icon representing a puzzle

2546: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
December 11, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for Russian team 11. Russian team 1 pt. 8,581
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 8,288
  3. Avatar for Team Brasil 13. Team Brasil 1 pt. 8,032
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 7,917

  1. Avatar for bravosk8erboy 11. bravosk8erboy Lv 1 48 pts. 9,778
  2. Avatar for g_b 12. g_b Lv 1 44 pts. 9,733
  3. Avatar for BootsMcGraw 13. BootsMcGraw Lv 1 41 pts. 9,733
  4. Avatar for Galaxie 14. Galaxie Lv 1 37 pts. 9,723
  5. Avatar for Punzi Baker 3 15. Punzi Baker 3 Lv 1 34 pts. 9,712
  6. Avatar for christioanchauvin 16. christioanchauvin Lv 1 32 pts. 9,639
  7. Avatar for georg137 17. georg137 Lv 1 29 pts. 9,612
  8. Avatar for WBarme1234 18. WBarme1234 Lv 1 27 pts. 9,569
  9. Avatar for Bletchley Park 19. Bletchley Park Lv 1 24 pts. 9,554
  10. Avatar for fpc 20. fpc Lv 1 22 pts. 9,550

Comments