Icon representing a puzzle

2546: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
December 11, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,046
  2. Avatar for Go Science 2. Go Science 68 pts. 9,913
  3. Avatar for Australia 3. Australia 44 pts. 9,827
  4. Avatar for Contenders 4. Contenders 27 pts. 9,733
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 9,639
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 9,569
  7. Avatar for Marvin's bunch 7. Marvin's bunch 5 pts. 9,550
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 9,545
  9. Avatar for VeFold 9. VeFold 1 pt. 9,516
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 9,217
  1. Avatar for bravosk8erboy 11. bravosk8erboy Lv 1 48 pts. 9,778
  2. Avatar for g_b 12. g_b Lv 1 44 pts. 9,733
  3. Avatar for BootsMcGraw 13. BootsMcGraw Lv 1 41 pts. 9,733
  4. Avatar for Galaxie 14. Galaxie Lv 1 37 pts. 9,723
  5. Avatar for Punzi Baker 3 15. Punzi Baker 3 Lv 1 34 pts. 9,712
  6. Avatar for christioanchauvin 16. christioanchauvin Lv 1 32 pts. 9,639
  7. Avatar for georg137 17. georg137 Lv 1 29 pts. 9,612
  8. Avatar for WBarme1234 18. WBarme1234 Lv 1 27 pts. 9,569
  9. Avatar for Bletchley Park 19. Bletchley Park Lv 1 24 pts. 9,554
  10. Avatar for fpc 20. fpc Lv 1 22 pts. 9,550

Comments