Icon representing a puzzle

2546: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
December 11, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,046
  2. Avatar for Go Science 2. Go Science 68 pts. 9,913
  3. Avatar for Australia 3. Australia 44 pts. 9,827
  4. Avatar for Contenders 4. Contenders 27 pts. 9,733
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 9,639
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 9,569
  7. Avatar for Marvin's bunch 7. Marvin's bunch 5 pts. 9,550
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 9,545
  9. Avatar for VeFold 9. VeFold 1 pt. 9,516
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 9,217
  1. Avatar for Mohoernchen 41. Mohoernchen Lv 1 2 pts. 8,992
  2. Avatar for Guille 42. Guille Lv 1 2 pts. 8,984
  3. Avatar for rosie4loop 43. rosie4loop Lv 1 2 pts. 8,948
  4. Avatar for audrec 44. audrec Lv 1 2 pts. 8,946
  5. Avatar for maithra 45. maithra Lv 1 1 pt. 8,896
  6. Avatar for Crossed Sticks 46. Crossed Sticks Lv 1 1 pt. 8,817
  7. Avatar for Gonegirl 47. Gonegirl Lv 1 1 pt. 8,757
  8. Avatar for haleyg 48. haleyg Lv 1 1 pt. 8,727
  9. Avatar for DScott 49. DScott Lv 1 1 pt. 8,708
  10. Avatar for Trajan464 50. Trajan464 Lv 1 1 pt. 8,691

Comments