Icon representing a puzzle

2546: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
December 11, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,046
  2. Avatar for Go Science 2. Go Science 68 pts. 9,913
  3. Avatar for Australia 3. Australia 44 pts. 9,827
  4. Avatar for Contenders 4. Contenders 27 pts. 9,733
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 9,639
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 9,569
  7. Avatar for Marvin's bunch 7. Marvin's bunch 5 pts. 9,550
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 9,545
  9. Avatar for VeFold 9. VeFold 1 pt. 9,516
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 9,217
  1. Avatar for Jenot96 61. Jenot96 Lv 1 1 pt. 8,079
  2. Avatar for claronis 62. claronis Lv 1 1 pt. 8,040
  3. Avatar for MathePro 63. MathePro Lv 1 1 pt. 8,032
  4. Avatar for Swapper242 64. Swapper242 Lv 1 1 pt. 8,012
  5. Avatar for froschi2 65. froschi2 Lv 1 1 pt. 7,976
  6. Avatar for furi0us 66. furi0us Lv 1 1 pt. 7,955
  7. Avatar for HiddenMoon 67. HiddenMoon Lv 1 1 pt. 7,952
  8. Avatar for futsall 68. futsall Lv 1 1 pt. 7,951
  9. Avatar for Lyneo 69. Lyneo Lv 1 1 pt. 7,943
  10. Avatar for geneticnomad 70. geneticnomad Lv 1 1 pt. 7,924

Comments