Placeholder image of a protein
Icon representing a puzzle

2548: Refine Density Reconstruction 17

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
December 11, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2261, which was Reconstruction Puzzle 26, but now we have the Refine Density tool available to make folds even better! his puzzle has a couple copies of two proteins as well as peptides bound.

Sequence
EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQVEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQV

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 22,160
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 19,983
  3. Avatar for incognito group 13. incognito group 1 pt. 12,844
  4. Avatar for Gargleblasters 14. Gargleblasters 1 pt. 12,844
  1. Avatar for georg137 21. georg137 Lv 1 19 pts. 22,858
  2. Avatar for fpc 22. fpc Lv 1 17 pts. 22,844
  3. Avatar for akaaka 23. akaaka Lv 1 16 pts. 22,833
  4. Avatar for rosie4loop 24. rosie4loop Lv 1 14 pts. 22,815
  5. Avatar for Larini 25. Larini Lv 1 13 pts. 22,733
  6. Avatar for abiogenesis 26. abiogenesis Lv 1 11 pts. 22,602
  7. Avatar for JuliaBCollet 27. JuliaBCollet Lv 1 10 pts. 22,588
  8. Avatar for kitsoune 28. kitsoune Lv 1 9 pts. 22,578
  9. Avatar for alcor29 29. alcor29 Lv 1 8 pts. 22,498
  10. Avatar for mengzach 30. mengzach Lv 1 7 pts. 22,475

Comments