Placeholder image of a protein
Icon representing a puzzle

2548: Refine Density Reconstruction 17

Closed since over 1 year ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
December 11, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2261, which was Reconstruction Puzzle 26, but now we have the Refine Density tool available to make folds even better! his puzzle has a couple copies of two proteins as well as peptides bound.

Sequence
EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQVEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQV

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 22,160
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 19,983
  3. Avatar for incognito group 13. incognito group 1 pt. 12,844
  4. Avatar for Gargleblasters 14. Gargleblasters 1 pt. 12,844

  1. Avatar for georg137 21. georg137 Lv 1 19 pts. 22,858
  2. Avatar for fpc 22. fpc Lv 1 17 pts. 22,844
  3. Avatar for akaaka 23. akaaka Lv 1 16 pts. 22,833
  4. Avatar for rosie4loop 24. rosie4loop Lv 1 14 pts. 22,815
  5. Avatar for Larini 25. Larini Lv 1 13 pts. 22,733
  6. Avatar for abiogenesis 26. abiogenesis Lv 1 11 pts. 22,602
  7. Avatar for JuliaBCollet 27. JuliaBCollet Lv 1 10 pts. 22,588
  8. Avatar for kitsoune 28. kitsoune Lv 1 9 pts. 22,578
  9. Avatar for alcor29 29. alcor29 Lv 1 8 pts. 22,498
  10. Avatar for mengzach 30. mengzach Lv 1 7 pts. 22,475

Comments