Placeholder image of a protein
Icon representing a puzzle

2548: Refine Density Reconstruction 17

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
December 11, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2261, which was Reconstruction Puzzle 26, but now we have the Refine Density tool available to make folds even better! his puzzle has a couple copies of two proteins as well as peptides bound.

Sequence
EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQVEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQV

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 22,160
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 19,983
  3. Avatar for incognito group 13. incognito group 1 pt. 12,844
  4. Avatar for Gargleblasters 14. Gargleblasters 1 pt. 12,844
  1. Avatar for ProfVince 31. ProfVince Lv 1 7 pts. 22,364
  2. Avatar for Hellcat6 32. Hellcat6 Lv 1 6 pts. 22,340
  3. Avatar for zbp 33. zbp Lv 1 5 pts. 22,312
  4. Avatar for hookedwarm 34. hookedwarm Lv 1 5 pts. 22,306
  5. Avatar for Th1sN@me!sN0tAPun 35. Th1sN@me!sN0tAPun Lv 1 4 pts. 22,275
  6. Avatar for zo3xiaJonWeinberg 36. zo3xiaJonWeinberg Lv 1 4 pts. 22,242
  7. Avatar for Serca 37. Serca Lv 1 3 pts. 22,238
  8. Avatar for Jenot96 38. Jenot96 Lv 1 3 pts. 22,165
  9. Avatar for TheGUmmer 39. TheGUmmer Lv 1 2 pts. 22,160
  10. Avatar for spvincent 40. spvincent Lv 1 2 pts. 22,135

Comments