Placeholder image of a protein
Icon representing a puzzle

2548: Refine Density Reconstruction 17

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
December 11, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2261, which was Reconstruction Puzzle 26, but now we have the Refine Density tool available to make folds even better! his puzzle has a couple copies of two proteins as well as peptides bound.

Sequence
EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQVEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQV

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 22,160
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 19,983
  3. Avatar for incognito group 13. incognito group 1 pt. 12,844
  4. Avatar for Gargleblasters 14. Gargleblasters 1 pt. 12,844
  1. Avatar for furi0us 61. furi0us Lv 1 1 pt. 21,020
  2. Avatar for harvardman 62. harvardman Lv 1 1 pt. 20,675
  3. Avatar for HelpME 63. HelpME Lv 1 1 pt. 19,983
  4. Avatar for KaDi 64. KaDi Lv 1 1 pt. 19,981
  5. Avatar for Fumiko 65. Fumiko Lv 1 1 pt. 19,903
  6. Avatar for ryu1031 66. ryu1031 Lv 1 1 pt. 14,795
  7. Avatar for AlinaBaki 67. AlinaBaki Lv 1 1 pt. 13,052
  8. Avatar for ingoneato 68. ingoneato Lv 1 1 pt. 12,844
  9. Avatar for antibot215 69. antibot215 Lv 1 1 pt. 12,844
  10. Avatar for metfolder99 70. metfolder99 Lv 1 1 pt. 12,844

Comments