Placeholder image of a protein
Icon representing a puzzle

2554: Refine Density Reconstruction 18

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
December 25, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2427, which was Reconstruction Puzzle 81, but now we have the Refine Density tool available to make folds even better! There's two chains here of the same thing, but both are missing a few residues that are slightly different.

Sequence
GSHMSLFDFFKNKGSAATATDRLKLILAKERTLNLPYMEEMRKEIIAVIQKYTKSSDIHFKTLDSNQSVETIEVEIILPR

Top groups

  1. Avatar for Street Smarts 11. Street Smarts 1 pt. 17,132
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 8,545
  1. Avatar for meatexplosion 11. meatexplosion Lv 1 43 pts. 18,936
  2. Avatar for grogar7 12. grogar7 Lv 1 39 pts. 18,881
  3. Avatar for WBarme1234 13. WBarme1234 Lv 1 36 pts. 18,854
  4. Avatar for NinjaGreg 14. NinjaGreg Lv 1 33 pts. 18,837
  5. Avatar for BootsMcGraw 15. BootsMcGraw Lv 1 30 pts. 18,809
  6. Avatar for dcrwheeler 16. dcrwheeler Lv 1 27 pts. 18,796
  7. Avatar for spvincent 17. spvincent Lv 1 24 pts. 18,752
  8. Avatar for hansvandenhof 18. hansvandenhof Lv 1 22 pts. 18,744
  9. Avatar for AlkiP0Ps 19. AlkiP0Ps Lv 1 20 pts. 18,739
  10. Avatar for Larini 20. Larini Lv 1 18 pts. 18,728

Comments