Placeholder image of a protein
Icon representing a puzzle

2554: Refine Density Reconstruction 18

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
December 25, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2427, which was Reconstruction Puzzle 81, but now we have the Refine Density tool available to make folds even better! There's two chains here of the same thing, but both are missing a few residues that are slightly different.

Sequence
GSHMSLFDFFKNKGSAATATDRLKLILAKERTLNLPYMEEMRKEIIAVIQKYTKSSDIHFKTLDSNQSVETIEVEIILPR

Top groups

  1. Avatar for Street Smarts 11. Street Smarts 1 pt. 17,132
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 8,545
  1. Avatar for Galaxie 21. Galaxie Lv 1 16 pts. 18,712
  2. Avatar for akaaka 22. akaaka Lv 1 14 pts. 18,673
  3. Avatar for BarrySampson 23. BarrySampson Lv 1 13 pts. 18,670
  4. Avatar for fpc 24. fpc Lv 1 11 pts. 18,666
  5. Avatar for kitsoune 25. kitsoune Lv 1 10 pts. 18,571
  6. Avatar for Anfinsen_slept_here 26. Anfinsen_slept_here Lv 1 9 pts. 18,505
  7. Avatar for pizpot 27. pizpot Lv 1 8 pts. 18,378
  8. Avatar for Hellcat6 28. Hellcat6 Lv 1 7 pts. 18,369
  9. Avatar for carxo 29. carxo Lv 1 6 pts. 18,350
  10. Avatar for pfirth 30. pfirth Lv 1 5 pts. 18,343

Comments