Placeholder image of a protein
Icon representing a puzzle

2554: Refine Density Reconstruction 18

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
December 25, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2427, which was Reconstruction Puzzle 81, but now we have the Refine Density tool available to make folds even better! There's two chains here of the same thing, but both are missing a few residues that are slightly different.

Sequence
GSHMSLFDFFKNKGSAATATDRLKLILAKERTLNLPYMEEMRKEIIAVIQKYTKSSDIHFKTLDSNQSVETIEVEIILPR

Top groups

  1. Avatar for Street Smarts 11. Street Smarts 1 pt. 17,132
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 8,545
  1. Avatar for Trajan464 31. Trajan464 Lv 1 5 pts. 18,323
  2. Avatar for abiogenesis 32. abiogenesis Lv 1 4 pts. 18,281
  3. Avatar for georg137 33. georg137 Lv 1 4 pts. 18,183
  4. Avatar for alcor29 34. alcor29 Lv 1 3 pts. 18,146
  5. Avatar for Th1sN@me!sN0tAPun 35. Th1sN@me!sN0tAPun Lv 1 3 pts. 18,100
  6. Avatar for hookedwarm 36. hookedwarm Lv 1 2 pts. 18,057
  7. Avatar for manu8170 37. manu8170 Lv 1 2 pts. 18,052
  8. Avatar for Vinara 38. Vinara Lv 1 2 pts. 18,033
  9. Avatar for Ikuso 39. Ikuso Lv 1 2 pts. 17,999
  10. Avatar for Hexafluorouranate 40. Hexafluorouranate Lv 1 1 pt. 17,995

Comments