Placeholder image of a protein
Icon representing a puzzle

2554: Refine Density Reconstruction 18

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
December 25, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2427, which was Reconstruction Puzzle 81, but now we have the Refine Density tool available to make folds even better! There's two chains here of the same thing, but both are missing a few residues that are slightly different.

Sequence
GSHMSLFDFFKNKGSAATATDRLKLILAKERTLNLPYMEEMRKEIIAVIQKYTKSSDIHFKTLDSNQSVETIEVEIILPR

Top groups

  1. Avatar for Street Smarts 11. Street Smarts 1 pt. 17,132
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 8,545
  1. Avatar for Merf 61. Merf Lv 1 1 pt. 16,453
  2. Avatar for harvardman 62. harvardman Lv 1 1 pt. 16,367
  3. Avatar for Maximus150 63. Maximus150 Lv 1 1 pt. 15,745
  4. Avatar for Fumiko 64. Fumiko Lv 1 1 pt. 15,455
  5. Avatar for rmoretti 65. rmoretti Lv 1 1 pt. 8,545

Comments