2554: Refine Density Reconstruction 18
Closed since over 1 year ago
Novice Overall Prediction Electron DensitySummary
- Created
- December 25, 2024
- Expires
- Max points
- 100
This is a protein we've given before in puzzle 2427, which was Reconstruction Puzzle 81, but now we have the Refine Density tool available to make folds even better! There's two chains here of the same thing, but both are missing a few residues that are slightly different.
- Sequence
- GSHMSLFDFFKNKGSAATATDRLKLILAKERTLNLPYMEEMRKEIIAVIQKYTKSSDIHFKTLDSNQSVETIEVEIILPR