Placeholder image of a protein
Icon representing a puzzle

2554: Refine Density Reconstruction 18

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
December 25, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2427, which was Reconstruction Puzzle 81, but now we have the Refine Density tool available to make folds even better! There's two chains here of the same thing, but both are missing a few residues that are slightly different.

Sequence
GSHMSLFDFFKNKGSAATATDRLKLILAKERTLNLPYMEEMRKEIIAVIQKYTKSSDIHFKTLDSNQSVETIEVEIILPR

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 19,379
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 19,234
  3. Avatar for Contenders 3. Contenders 37 pts. 19,224
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 19,190
  5. Avatar for Void Crushers 5. Void Crushers 11 pts. 18,968
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 5 pts. 18,854
  7. Avatar for Australia 7. Australia 2 pts. 18,739
  8. Avatar for VeFold 8. VeFold 1 pt. 18,670
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 18,666
  10. Avatar for Kotocycle 10. Kotocycle 1 pt. 17,999
  1. Avatar for JuliaBCollet 41. JuliaBCollet Lv 1 1 pt. 17,963
  2. Avatar for jamiexq 42. jamiexq Lv 1 1 pt. 17,928
  3. Avatar for davidoskky 43. davidoskky Lv 1 1 pt. 17,896
  4. Avatar for nicobul 44. nicobul Lv 1 1 pt. 17,810
  5. Avatar for Mohoernchen 45. Mohoernchen Lv 1 1 pt. 17,810
  6. Avatar for zbp 46. zbp Lv 1 1 pt. 17,787
  7. Avatar for Dr.Sillem 47. Dr.Sillem Lv 1 1 pt. 17,731
  8. Avatar for maithra 48. maithra Lv 1 1 pt. 17,699
  9. Avatar for Steven Pletsch 49. Steven Pletsch Lv 1 1 pt. 17,677
  10. Avatar for vybi 50. vybi Lv 1 1 pt. 17,670

Comments