Placeholder image of a protein
Icon representing a puzzle

2554: Refine Density Reconstruction 18

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
December 25, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2427, which was Reconstruction Puzzle 81, but now we have the Refine Density tool available to make folds even better! There's two chains here of the same thing, but both are missing a few residues that are slightly different.

Sequence
GSHMSLFDFFKNKGSAATATDRLKLILAKERTLNLPYMEEMRKEIIAVIQKYTKSSDIHFKTLDSNQSVETIEVEIILPR

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 19,379
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 19,234
  3. Avatar for Contenders 3. Contenders 37 pts. 19,224
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 19,190
  5. Avatar for Void Crushers 5. Void Crushers 11 pts. 18,968
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 5 pts. 18,854
  7. Avatar for Australia 7. Australia 2 pts. 18,739
  8. Avatar for VeFold 8. VeFold 1 pt. 18,670
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 18,666
  10. Avatar for Kotocycle 10. Kotocycle 1 pt. 17,999
  1. Avatar for mnucer 51. mnucer Lv 1 1 pt. 17,474
  2. Avatar for rinze 52. rinze Lv 1 1 pt. 17,237
  3. Avatar for Will the pill 53. Will the pill Lv 1 1 pt. 17,132
  4. Avatar for DScott 54. DScott Lv 1 1 pt. 16,810
  5. Avatar for efull 55. efull Lv 1 1 pt. 16,686
  6. Avatar for RWoodcock 56. RWoodcock Lv 1 1 pt. 16,618
  7. Avatar for fact0rial 57. fact0rial Lv 1 1 pt. 16,582
  8. Avatar for glaminator 58. glaminator Lv 1 1 pt. 16,550
  9. Avatar for futsall 59. futsall Lv 1 1 pt. 16,464
  10. Avatar for furi0us 60. furi0us Lv 1 1 pt. 16,462

Comments