Icon representing a puzzle

2552: Revisiting Puzzle 87: Zinc Binding Protein

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
December 25, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,136
  2. Avatar for Go Science 2. Go Science 70 pts. 9,107
  3. Avatar for Contenders 3. Contenders 47 pts. 9,095
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 8,967
  5. Avatar for VeFold 5. VeFold 19 pts. 8,884
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 11 pts. 8,825
  7. Avatar for Australia 7. Australia 7 pts. 8,801
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 8,727
  9. Avatar for SETI.Germany 9. SETI.Germany 2 pts. 8,309
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 8,292
  1. Avatar for hada 41. hada Lv 1 3 pts. 8,338
  2. Avatar for Merf 42. Merf Lv 1 2 pts. 8,322
  3. Avatar for Alistair69 43. Alistair69 Lv 1 2 pts. 8,310
  4. Avatar for dahast.de 44. dahast.de Lv 1 2 pts. 8,309
  5. Avatar for TheGUmmer 45. TheGUmmer Lv 1 2 pts. 8,292
  6. Avatar for Mohoernchen 46. Mohoernchen Lv 1 1 pt. 8,259
  7. Avatar for maithra 47. maithra Lv 1 1 pt. 8,252
  8. Avatar for DScott 48. DScott Lv 1 1 pt. 8,245
  9. Avatar for Gerom 49. Gerom Lv 1 1 pt. 8,235
  10. Avatar for drumpeter18yrs9yrs 50. drumpeter18yrs9yrs Lv 1 1 pt. 8,232

Comments

rmoretti Staff Lv 1

Issue with .otxt should be fixed now – puzzle should be able to be loaded. (Though you may have to close and reopen your client in order to get the updated file list for the puzzle.)