Icon representing a puzzle

2552: Revisiting Puzzle 87: Zinc Binding Protein

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
December 25, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,136
  2. Avatar for Go Science 2. Go Science 70 pts. 9,107
  3. Avatar for Contenders 3. Contenders 47 pts. 9,095
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 8,967
  5. Avatar for VeFold 5. VeFold 19 pts. 8,884
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 11 pts. 8,825
  7. Avatar for Australia 7. Australia 7 pts. 8,801
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 8,727
  9. Avatar for SETI.Germany 9. SETI.Germany 2 pts. 8,309
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 8,292
  1. Avatar for frostschutz 51. frostschutz Lv 1 1 pt. 8,177
  2. Avatar for Trajan464 52. Trajan464 Lv 1 1 pt. 8,085
  3. Avatar for zbp 53. zbp Lv 1 1 pt. 8,054
  4. Avatar for rosie4loop 54. rosie4loop Lv 1 1 pt. 7,911
  5. Avatar for Keizertje 55. Keizertje Lv 1 1 pt. 7,896
  6. Avatar for rdolan9007@btinternet.com 56. rdolan9007@btinternet.com Lv 1 1 pt. 7,890
  7. Avatar for rinze 57. rinze Lv 1 1 pt. 7,864
  8. Avatar for mengzach 58. mengzach Lv 1 1 pt. 7,819
  9. Avatar for TNTforpro 59. TNTforpro Lv 1 1 pt. 7,806
  10. Avatar for metfolder99 60. metfolder99 Lv 1 1 pt. 7,751

Comments

rmoretti Staff Lv 1

Issue with .otxt should be fixed now – puzzle should be able to be loaded. (Though you may have to close and reopen your client in order to get the updated file list for the puzzle.)