Icon representing a puzzle

2558: Revisiting Puzzle 89: Cow Eye

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
January 08, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,647
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 10,555
  3. Avatar for Gargleblasters 13. Gargleblasters 1 pt. 10,422
  4. Avatar for METU-BIN 14. METU-BIN 1 pt. 9,517
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,160
  1. Avatar for JuliaBCollet 21. JuliaBCollet Lv 1 20 pts. 11,090
  2. Avatar for alcor29 22. alcor29 Lv 1 18 pts. 11,078
  3. Avatar for Ikuso 23. Ikuso Lv 1 16 pts. 11,047
  4. Avatar for maithra 24. maithra Lv 1 15 pts. 11,021
  5. Avatar for dcrwheeler 25. dcrwheeler Lv 1 13 pts. 11,002
  6. Avatar for rosie4loop 26. rosie4loop Lv 1 12 pts. 10,991
  7. Avatar for hansvandenhof 27. hansvandenhof Lv 1 11 pts. 10,947
  8. Avatar for Hexafluorouranate 28. Hexafluorouranate Lv 1 10 pts. 10,915
  9. Avatar for Gerom 29. Gerom Lv 1 9 pts. 10,904
  10. Avatar for hookedwarm 30. hookedwarm Lv 1 8 pts. 10,866

Comments