Icon representing a puzzle

2558: Revisiting Puzzle 89: Cow Eye

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
January 08, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,647
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 10,555
  3. Avatar for Gargleblasters 13. Gargleblasters 1 pt. 10,422
  4. Avatar for METU-BIN 14. METU-BIN 1 pt. 9,517
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,160
  1. Avatar for Jenot96 61. Jenot96 Lv 1 1 pt. 9,649
  2. Avatar for efull 62. efull Lv 1 1 pt. 9,524
  3. Avatar for alevbozan 63. alevbozan Lv 1 1 pt. 9,517
  4. Avatar for Merf 64. Merf Lv 1 1 pt. 9,478
  5. Avatar for Swapper242 65. Swapper242 Lv 1 1 pt. 9,352
  6. Avatar for Anfinsen_slept_here 66. Anfinsen_slept_here Lv 1 1 pt. 9,336
  7. Avatar for glaminator 67. glaminator Lv 1 1 pt. 9,317
  8. Avatar for furi0us 68. furi0us Lv 1 1 pt. 9,305
  9. Avatar for harvardman 69. harvardman Lv 1 1 pt. 9,185
  10. Avatar for Sammy3c2b1a0 70. Sammy3c2b1a0 Lv 1 1 pt. 9,160

Comments