Placeholder image of a protein
Icon representing a puzzle

2560: Electron Density Reconstruction 104

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
January 09, 2025
Expires
Max points
100
Description

We're going to take a break from the Refine Density puzzles to do a more old-fashioned Reconstruction puzzle. The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's rather large, so we definitely recommend the trim tool on this one. There's also a number of residues missing in this particular case.

Sequence
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN. FHCVPRDLSWLDLEANMCLP

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 34,682
  1. Avatar for BarrySampson 21. BarrySampson Lv 1 21 pts. 40,411
  2. Avatar for Idiotboy 22. Idiotboy Lv 1 19 pts. 40,261
  3. Avatar for jamiexq 23. jamiexq Lv 1 18 pts. 40,078
  4. Avatar for Simek 24. Simek Lv 1 16 pts. 40,071
  5. Avatar for hookedwarm 25. hookedwarm Lv 1 15 pts. 40,065
  6. Avatar for alcor29 26. alcor29 Lv 1 13 pts. 39,928
  7. Avatar for davidoskky 27. davidoskky Lv 1 12 pts. 39,831
  8. Avatar for Trajan464 28. Trajan464 Lv 1 11 pts. 39,653
  9. Avatar for Dr.Sillem 29. Dr.Sillem Lv 1 10 pts. 39,450
  10. Avatar for nicobul 30. nicobul Lv 1 9 pts. 39,269

Comments