Placeholder image of a protein
Icon representing a puzzle

2560: Electron Density Reconstruction 104

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
January 09, 2025
Expires
Max points
100
Description

We're going to take a break from the Refine Density puzzles to do a more old-fashioned Reconstruction puzzle. The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's rather large, so we definitely recommend the trim tool on this one. There's also a number of residues missing in this particular case.

Sequence
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN. FHCVPRDLSWLDLEANMCLP

Top groups


  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 34,682

  1. Avatar for manu8170 31. manu8170 Lv 1 8 pts. 38,846
  2. Avatar for Crossed Sticks 32. Crossed Sticks Lv 1 7 pts. 38,832
  3. Avatar for Anfinsen_slept_here 33. Anfinsen_slept_here Lv 1 6 pts. 38,760
  4. Avatar for nellasdim 34. nellasdim Lv 1 6 pts. 38,606
  5. Avatar for Alistair69 35. Alistair69 Lv 1 5 pts. 38,500
  6. Avatar for hansvandenhof 36. hansvandenhof Lv 1 5 pts. 38,372
  7. Avatar for zbp 37. zbp Lv 1 4 pts. 38,187
  8. Avatar for abiogenesis 38. abiogenesis Lv 1 4 pts. 38,091
  9. Avatar for Larini 39. Larini Lv 1 3 pts. 38,048
  10. Avatar for pizpot 40. pizpot Lv 1 3 pts. 37,864

Comments