Icon representing a puzzle

2561: Revisiting Puzzle 90: Heliomicin

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
January 15, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 8,415
  2. Avatar for METU-BIN 12. METU-BIN 1 pt. 8,375
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 7,729
  1. Avatar for Hellcat6 41. Hellcat6 Lv 1 2 pts. 9,021
  2. Avatar for carsonfb 42. carsonfb Lv 1 2 pts. 9,005
  3. Avatar for Anfinsen_slept_here 43. Anfinsen_slept_here Lv 1 1 pt. 8,934
  4. Avatar for pizpot 44. pizpot Lv 1 1 pt. 8,894
  5. Avatar for Dr.Sillem 45. Dr.Sillem Lv 1 1 pt. 8,893
  6. Avatar for carxo 46. carxo Lv 1 1 pt. 8,859
  7. Avatar for kitsoune 47. kitsoune Lv 1 1 pt. 8,836
  8. Avatar for nancy_naniewoo 48. nancy_naniewoo Lv 1 1 pt. 8,744
  9. Avatar for Mohoernchen 49. Mohoernchen Lv 1 1 pt. 8,719
  10. Avatar for Larini 50. Larini Lv 1 1 pt. 8,575

Comments