Icon representing a puzzle

2569: Revisiting Puzzle 93: Spider Toxin

Closed since over 1 year ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 05, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 8,865
  2. Avatar for BIOTF345 12. BIOTF345 1 pt. 7,955
  3. Avatar for BIOF215 13. BIOF215 1 pt. 7,549

  1. Avatar for Dr.Sillem 51. Dr.Sillem Lv 1 2 pts. 8,534
  2. Avatar for Alistair69 52. Alistair69 Lv 1 2 pts. 8,534
  3. Avatar for RWoodcock 53. RWoodcock Lv 1 2 pts. 8,490
  4. Avatar for altaris 54. altaris Lv 1 2 pts. 8,395
  5. Avatar for Mohoernchen 55. Mohoernchen Lv 1 2 pts. 8,389
  6. Avatar for zbp 56. zbp Lv 1 1 pt. 8,362
  7. Avatar for Trajan464 57. Trajan464 Lv 1 1 pt. 8,293
  8. Avatar for fisherlr777 58. fisherlr777 Lv 1 1 pt. 8,255
  9. Avatar for Ege 59. Ege Lv 1 1 pt. 8,181
  10. Avatar for film2860 60. film2860 Lv 1 1 pt. 8,148

Comments


beta_helix Staff Lv 1

Sorry, we had a server hiccup last week and we thought we had addressed all the issues stemming from it