Icon representing a puzzle

2569: Revisiting Puzzle 93: Spider Toxin

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
February 05, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,012
  2. Avatar for Go Science 2. Go Science 65 pts. 9,963
  3. Avatar for VeFold 3. VeFold 41 pts. 9,890
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 9,887
  5. Avatar for Contenders 5. Contenders 14 pts. 9,881
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 9,742
  7. Avatar for Void Crushers 7. Void Crushers 4 pts. 9,726
  8. Avatar for Australia 8. Australia 2 pts. 9,695
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 9,662
  10. Avatar for Kotocycle 10. Kotocycle 1 pt. 9,293
  1. Avatar for Dr.Sillem 51. Dr.Sillem Lv 1 2 pts. 8,534
  2. Avatar for Alistair69 52. Alistair69 Lv 1 2 pts. 8,534
  3. Avatar for RWoodcock 53. RWoodcock Lv 1 2 pts. 8,490
  4. Avatar for altaris 54. altaris Lv 1 2 pts. 8,395
  5. Avatar for Mohoernchen 55. Mohoernchen Lv 1 2 pts. 8,389
  6. Avatar for zbp 56. zbp Lv 1 1 pt. 8,362
  7. Avatar for Trajan464 57. Trajan464 Lv 1 1 pt. 8,293
  8. Avatar for fisherlr777 58. fisherlr777 Lv 1 1 pt. 8,255
  9. Avatar for Ege 59. Ege Lv 1 1 pt. 8,181
  10. Avatar for film2860 60. film2860 Lv 1 1 pt. 8,148

Comments

beta_helix Staff Lv 1

Sorry, we had a server hiccup last week and we thought we had addressed all the issues stemming from it