Icon representing a puzzle

2569: Revisiting Puzzle 93: Spider Toxin

Closed since over 1 year ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 05, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,012
  2. Avatar for Go Science 2. Go Science 65 pts. 9,963
  3. Avatar for VeFold 3. VeFold 41 pts. 9,890
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 9,887
  5. Avatar for Contenders 5. Contenders 14 pts. 9,881
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 9,742
  7. Avatar for Void Crushers 7. Void Crushers 4 pts. 9,726
  8. Avatar for Australia 8. Australia 2 pts. 9,695
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 9,662
  10. Avatar for Kotocycle 10. Kotocycle 1 pt. 9,293

  1. Avatar for bcd 71. bcd Lv 1 1 pt. 7,417
  2. Avatar for kitsoune 72. kitsoune Lv 1 1 pt. 7,400
  3. Avatar for aditik 73. aditik Lv 1 1 pt. 7,389
  4. Avatar for AlphaFold2 74. AlphaFold2 Lv 1 1 pt. 7,362
  5. Avatar for Larini 75. Larini Lv 1 1 pt. 7,326
  6. Avatar for glaminator 76. glaminator Lv 1 1 pt. 6,999
  7. Avatar for the_platinum 77. the_platinum Lv 1 1 pt. 6,948
  8. Avatar for mrsk56 78. mrsk56 Lv 1 1 pt. 6,924
  9. Avatar for kockuba 79. kockuba Lv 1 1 pt. 6,902
  10. Avatar for Sydefecks 80. Sydefecks Lv 1 1 pt. 6,853

Comments


beta_helix Staff Lv 1

Sorry, we had a server hiccup last week and we thought we had addressed all the issues stemming from it