Icon representing a puzzle

2569: Revisiting Puzzle 93: Spider Toxin

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
February 05, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,012
  2. Avatar for Go Science 2. Go Science 65 pts. 9,963
  3. Avatar for VeFold 3. VeFold 41 pts. 9,890
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 9,887
  5. Avatar for Contenders 5. Contenders 14 pts. 9,881
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 9,742
  7. Avatar for Void Crushers 7. Void Crushers 4 pts. 9,726
  8. Avatar for Australia 8. Australia 2 pts. 9,695
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 9,662
  10. Avatar for Kotocycle 10. Kotocycle 1 pt. 9,293
  1. Avatar for Th1sN@me!sN0tAPun 41. Th1sN@me!sN0tAPun Lv 1 6 pts. 9,003
  2. Avatar for ShadowTactics 42. ShadowTactics Lv 1 5 pts. 8,865
  3. Avatar for ProfVince 43. ProfVince Lv 1 5 pts. 8,839
  4. Avatar for abiogenesis 44. abiogenesis Lv 1 4 pts. 8,804
  5. Avatar for roarshock 45. roarshock Lv 1 4 pts. 8,776
  6. Avatar for vybi 46. vybi Lv 1 4 pts. 8,740
  7. Avatar for carxo 47. carxo Lv 1 3 pts. 8,687
  8. Avatar for frostschutz 48. frostschutz Lv 1 3 pts. 8,653
  9. Avatar for Simek 49. Simek Lv 1 3 pts. 8,593
  10. Avatar for Bronypedia 50. Bronypedia Lv 1 2 pts. 8,540

Comments

beta_helix Staff Lv 1

Sorry, we had a server hiccup last week and we thought we had addressed all the issues stemming from it