Icon representing a puzzle

2573: Revisiting Puzzle 94: Mouse

Closed since about 1 year ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 12, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups


  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 9,591
  2. Avatar for Russian team 12. Russian team 1 pt. 9,358
  3. Avatar for chemiosmotic 13. chemiosmotic 1 pt. 9,056
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,723
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 8,000

  1. Avatar for melonogaster 61. melonogaster Lv 1 1 pt. 8,783
  2. Avatar for zbp 62. zbp Lv 1 1 pt. 8,767
  3. Avatar for nede123 63. nede123 Lv 1 1 pt. 8,725
  4. Avatar for alyssa_d_V2.0 64. alyssa_d_V2.0 Lv 1 1 pt. 8,723
  5. Avatar for rinze 65. rinze Lv 1 1 pt. 8,611
  6. Avatar for Ewink 66. Ewink Lv 1 1 pt. 8,605
  7. Avatar for sandeepned 67. sandeepned Lv 1 1 pt. 8,579
  8. Avatar for Jacloch 68. Jacloch Lv 1 1 pt. 8,546
  9. Avatar for Guinea_Pig_Lord 69. Guinea_Pig_Lord Lv 1 1 pt. 8,524
  10. Avatar for Luca 70. Luca Lv 1 1 pt. 8,478

Comments