Icon representing a puzzle

2573: Revisiting Puzzle 94: Mouse

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
February 12, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,645
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 10,520
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 47 pts. 10,249
  4. Avatar for Contenders 4. Contenders 30 pts. 10,201
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 10,101
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 10,079
  7. Avatar for Australia 7. Australia 7 pts. 9,987
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 9,980
  9. Avatar for VeFold 9. VeFold 2 pts. 9,944
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 9,764
  1. Avatar for melonogaster 61. melonogaster Lv 1 1 pt. 8,783
  2. Avatar for zbp 62. zbp Lv 1 1 pt. 8,767
  3. Avatar for nede123 63. nede123 Lv 1 1 pt. 8,725
  4. Avatar for alyssa_d_V2.0 64. alyssa_d_V2.0 Lv 1 1 pt. 8,723
  5. Avatar for rinze 65. rinze Lv 1 1 pt. 8,611
  6. Avatar for Ewink 66. Ewink Lv 1 1 pt. 8,605
  7. Avatar for sandeepned 67. sandeepned Lv 1 1 pt. 8,579
  8. Avatar for Jacloch 68. Jacloch Lv 1 1 pt. 8,546
  9. Avatar for Guinea_Pig_Lord 69. Guinea_Pig_Lord Lv 1 1 pt. 8,524
  10. Avatar for Luca 70. Luca Lv 1 1 pt. 8,478

Comments