Icon representing a puzzle

2573: Revisiting Puzzle 94: Mouse

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
February 12, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,645
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 10,520
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 47 pts. 10,249
  4. Avatar for Contenders 4. Contenders 30 pts. 10,201
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 10,101
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 10,079
  7. Avatar for Australia 7. Australia 7 pts. 9,987
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 9,980
  9. Avatar for VeFold 9. VeFold 2 pts. 9,944
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 9,764
  1. Avatar for Bruno Kestemont 21. Bruno Kestemont Lv 1 27 pts. 10,030
  2. Avatar for AlkiP0Ps 22. AlkiP0Ps Lv 1 25 pts. 9,987
  3. Avatar for orily1337 23. orily1337 Lv 1 23 pts. 9,980
  4. Avatar for Anfinsen_slept_here 24. Anfinsen_slept_here Lv 1 21 pts. 9,972
  5. Avatar for JuliaBCollet 25. JuliaBCollet Lv 1 20 pts. 9,906
  6. Avatar for Hellcat6 26. Hellcat6 Lv 1 18 pts. 9,901
  7. Avatar for heather-1 27. heather-1 Lv 1 17 pts. 9,853
  8. Avatar for stomjoh 28. stomjoh Lv 1 15 pts. 9,846
  9. Avatar for jausmh 29. jausmh Lv 1 14 pts. 9,843
  10. Avatar for Th1sN@me!sN0tAPun 30. Th1sN@me!sN0tAPun Lv 1 13 pts. 9,821

Comments