Icon representing a puzzle

2573: Revisiting Puzzle 94: Mouse

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
February 12, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,645
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 10,520
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 47 pts. 10,249
  4. Avatar for Contenders 4. Contenders 30 pts. 10,201
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 10,101
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 10,079
  7. Avatar for Australia 7. Australia 7 pts. 9,987
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 9,980
  9. Avatar for VeFold 9. VeFold 2 pts. 9,944
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 9,764
  1. Avatar for SWR_DMaster 51. SWR_DMaster Lv 1 2 pts. 9,139
  2. Avatar for carxo 52. carxo Lv 1 2 pts. 9,119
  3. Avatar for Alistair69 53. Alistair69 Lv 1 1 pt. 9,074
  4. Avatar for georg137 54. georg137 Lv 1 1 pt. 9,056
  5. Avatar for Kvaksius 55. Kvaksius Lv 1 1 pt. 9,056
  6. Avatar for Trajan464 56. Trajan464 Lv 1 1 pt. 8,976
  7. Avatar for somers 57. somers Lv 1 1 pt. 8,975
  8. Avatar for RWoodcock 58. RWoodcock Lv 1 1 pt. 8,909
  9. Avatar for fisherlr777 59. fisherlr777 Lv 1 1 pt. 8,834
  10. Avatar for DScott 60. DScott Lv 1 1 pt. 8,818

Comments