Icon representing a puzzle

2576: Revisiting Puzzle 95: Chicken

Closed since about 1 year ago

Novice Overall Prediction

Summary


Created
February 19, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 8,931

  1. Avatar for christioanchauvin 11. christioanchauvin Lv 1 46 pts. 10,549
  2. Avatar for gmn 12. gmn Lv 1 42 pts. 10,540
  3. Avatar for g_b 13. g_b Lv 1 38 pts. 10,530
  4. Avatar for meatexplosion 14. meatexplosion Lv 1 35 pts. 10,478
  5. Avatar for Bletchley Park 15. Bletchley Park Lv 1 32 pts. 10,470
  6. Avatar for AlkiP0Ps 16. AlkiP0Ps Lv 1 29 pts. 10,459
  7. Avatar for georg137 17. georg137 Lv 1 27 pts. 10,416
  8. Avatar for TheGUmmer 18. TheGUmmer Lv 1 24 pts. 10,399
  9. Avatar for jamiexq 19. jamiexq Lv 1 22 pts. 10,382
  10. Avatar for NinjaGreg 20. NinjaGreg Lv 1 20 pts. 10,374

Comments