Icon representing a puzzle

2578: Revisiting Puzzle 96: Collagen

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
February 26, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 8,873
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 8,115
  3. Avatar for SHELL 13. SHELL 1 pt. 8,081
  4. Avatar for porpita porpita 14. porpita porpita 1 pt. 6,256
  1. Avatar for gmn 11. gmn Lv 1 43 pts. 9,955
  2. Avatar for BootsMcGraw 12. BootsMcGraw Lv 1 39 pts. 9,955
  3. Avatar for Punzi Baker 3 13. Punzi Baker 3 Lv 1 35 pts. 9,913
  4. Avatar for AlkiP0Ps 14. AlkiP0Ps Lv 1 32 pts. 9,896
  5. Avatar for meatexplosion 15. meatexplosion Lv 1 29 pts. 9,874
  6. Avatar for WBarme1234 16. WBarme1234 Lv 1 26 pts. 9,870
  7. Avatar for Galaxie 17. Galaxie Lv 1 24 pts. 9,856
  8. Avatar for BarrySampson 18. BarrySampson Lv 1 21 pts. 9,844
  9. Avatar for Anfinsen_slept_here 19. Anfinsen_slept_here Lv 1 19 pts. 9,773
  10. Avatar for NinjaGreg 20. NinjaGreg Lv 1 17 pts. 9,770

Comments