Icon representing a puzzle

2578: Revisiting Puzzle 96: Collagen

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
February 26, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,292
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 10,261
  3. Avatar for Void Crushers 3. Void Crushers 44 pts. 10,055
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 9,965
  5. Avatar for Contenders 5. Contenders 16 pts. 9,955
  6. Avatar for Australia 6. Australia 9 pts. 9,896
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 9,870
  8. Avatar for VeFold 8. VeFold 3 pts. 9,844
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 9,146
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 9,035
  1. Avatar for gmn 11. gmn Lv 1 43 pts. 9,955
  2. Avatar for BootsMcGraw 12. BootsMcGraw Lv 1 39 pts. 9,955
  3. Avatar for Punzi Baker 3 13. Punzi Baker 3 Lv 1 35 pts. 9,913
  4. Avatar for AlkiP0Ps 14. AlkiP0Ps Lv 1 32 pts. 9,896
  5. Avatar for meatexplosion 15. meatexplosion Lv 1 29 pts. 9,874
  6. Avatar for WBarme1234 16. WBarme1234 Lv 1 26 pts. 9,870
  7. Avatar for Galaxie 17. Galaxie Lv 1 24 pts. 9,856
  8. Avatar for BarrySampson 18. BarrySampson Lv 1 21 pts. 9,844
  9. Avatar for Anfinsen_slept_here 19. Anfinsen_slept_here Lv 1 19 pts. 9,773
  10. Avatar for NinjaGreg 20. NinjaGreg Lv 1 17 pts. 9,770

Comments