Icon representing a puzzle

2578: Revisiting Puzzle 96: Collagen

Closed since over 1 year ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 26, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Team China 11. Team China 1 pt. 8,873
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 8,115
  3. Avatar for SHELL 13. SHELL 1 pt. 8,081
  4. Avatar for porpita porpita 14. porpita porpita 1 pt. 6,256

  1. Avatar for Dr.Sillem 31. Dr.Sillem Lv 1 4 pts. 9,207
  2. Avatar for Alistair69 32. Alistair69 Lv 1 4 pts. 9,193
  3. Avatar for jausmh 33. jausmh Lv 1 3 pts. 9,146
  4. Avatar for SWR_DMaster 34. SWR_DMaster Lv 1 3 pts. 9,139
  5. Avatar for Bletchley Park 35. Bletchley Park Lv 1 3 pts. 9,049
  6. Avatar for ShadowTactics 36. ShadowTactics Lv 1 2 pts. 9,035
  7. Avatar for nicobul 37. nicobul Lv 1 2 pts. 8,980
  8. Avatar for abiogenesis 38. abiogenesis Lv 1 2 pts. 8,960
  9. Avatar for zo3xiaJonWeinberg 39. zo3xiaJonWeinberg Lv 1 1 pt. 8,873
  10. Avatar for rinze 40. rinze Lv 1 1 pt. 8,871

Comments