Icon representing a puzzle

2578: Revisiting Puzzle 96: Collagen

Closed since over 1 year ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 26, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Go Science 100 pts. 10,292
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 10,261
  3. Avatar for Void Crushers 3. Void Crushers 44 pts. 10,055
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 9,965
  5. Avatar for Contenders 5. Contenders 16 pts. 9,955
  6. Avatar for Australia 6. Australia 9 pts. 9,896
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 9,870
  8. Avatar for VeFold 8. VeFold 3 pts. 9,844
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 9,146
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 9,035

  1. Avatar for Dr.Sillem 31. Dr.Sillem Lv 1 4 pts. 9,207
  2. Avatar for Alistair69 32. Alistair69 Lv 1 4 pts. 9,193
  3. Avatar for jausmh 33. jausmh Lv 1 3 pts. 9,146
  4. Avatar for SWR_DMaster 34. SWR_DMaster Lv 1 3 pts. 9,139
  5. Avatar for Bletchley Park 35. Bletchley Park Lv 1 3 pts. 9,049
  6. Avatar for ShadowTactics 36. ShadowTactics Lv 1 2 pts. 9,035
  7. Avatar for nicobul 37. nicobul Lv 1 2 pts. 8,980
  8. Avatar for abiogenesis 38. abiogenesis Lv 1 2 pts. 8,960
  9. Avatar for zo3xiaJonWeinberg 39. zo3xiaJonWeinberg Lv 1 1 pt. 8,873
  10. Avatar for rinze 40. rinze Lv 1 1 pt. 8,871

Comments