Icon representing a puzzle

2583: Revisiting Puzzle 109: Pumpkin

Closed since about 1 year ago

Novice Overall Prediction

Summary


Created
March 12, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.

Sequence
SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Team China 11. Team China 1 pt. 8,349

  1. Avatar for Punzi Baker 3 11. Punzi Baker 3 Lv 1 47 pts. 9,149
  2. Avatar for akaaka 12. akaaka Lv 1 44 pts. 9,128
  3. Avatar for grogar7 13. grogar7 Lv 1 40 pts. 9,112
  4. Avatar for gmn 14. gmn Lv 1 37 pts. 9,104
  5. Avatar for Aubade01 15. Aubade01 Lv 1 34 pts. 9,104
  6. Avatar for christioanchauvin 16. christioanchauvin Lv 1 31 pts. 9,092
  7. Avatar for WBarme1234 17. WBarme1234 Lv 1 28 pts. 9,078
  8. Avatar for BarrySampson 18. BarrySampson Lv 1 26 pts. 9,074
  9. Avatar for Anfinsen_slept_here 19. Anfinsen_slept_here Lv 1 24 pts. 9,069
  10. Avatar for Galaxie 20. Galaxie Lv 1 22 pts. 9,065

Comments