Icon representing a puzzle

2583: Revisiting Puzzle 109: Pumpkin

Closed since 12 months ago

Novice Overall Prediction

Summary

Created
March 12, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.

Sequence
SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,284
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 60 pts. 9,266
  3. Avatar for Contenders 3. Contenders 33 pts. 9,259
  4. Avatar for Marvin's bunch 4. Marvin's bunch 17 pts. 9,212
  5. Avatar for Void Crushers 5. Void Crushers 8 pts. 9,169
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 4 pts. 9,092
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 9,078
  8. Avatar for VeFold 8. VeFold 1 pt. 9,074
  9. Avatar for Australia 9. Australia 1 pt. 9,011
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 1 pt. 8,427
  1. Avatar for Punzi Baker 3 11. Punzi Baker 3 Lv 1 47 pts. 9,149
  2. Avatar for akaaka 12. akaaka Lv 1 44 pts. 9,128
  3. Avatar for grogar7 13. grogar7 Lv 1 40 pts. 9,112
  4. Avatar for gmn 14. gmn Lv 1 37 pts. 9,104
  5. Avatar for Aubade01 15. Aubade01 Lv 1 34 pts. 9,104
  6. Avatar for christioanchauvin 16. christioanchauvin Lv 1 31 pts. 9,092
  7. Avatar for WBarme1234 17. WBarme1234 Lv 1 28 pts. 9,078
  8. Avatar for BarrySampson 18. BarrySampson Lv 1 26 pts. 9,074
  9. Avatar for Anfinsen_slept_here 19. Anfinsen_slept_here Lv 1 24 pts. 9,069
  10. Avatar for Galaxie 20. Galaxie Lv 1 22 pts. 9,065

Comments