Icon representing a puzzle

2583: Revisiting Puzzle 109: Pumpkin

Closed since 12 months ago

Novice Overall Prediction

Summary

Created
March 12, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.

Sequence
SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,284
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 60 pts. 9,266
  3. Avatar for Contenders 3. Contenders 33 pts. 9,259
  4. Avatar for Marvin's bunch 4. Marvin's bunch 17 pts. 9,212
  5. Avatar for Void Crushers 5. Void Crushers 8 pts. 9,169
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 4 pts. 9,092
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 9,078
  8. Avatar for VeFold 8. VeFold 1 pt. 9,074
  9. Avatar for Australia 9. Australia 1 pt. 9,011
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 1 pt. 8,427
  1. Avatar for zbp 41. zbp Lv 1 2 pts. 8,714
  2. Avatar for abiogenesis 42. abiogenesis Lv 1 2 pts. 8,705
  3. Avatar for carxo 43. carxo Lv 1 2 pts. 8,671
  4. Avatar for rosie4loop 44. rosie4loop Lv 1 1 pt. 8,648
  5. Avatar for Fasodankfds 45. Fasodankfds Lv 1 1 pt. 8,617
  6. Avatar for RWoodcock 46. RWoodcock Lv 1 1 pt. 8,596
  7. Avatar for froschi2 47. froschi2 Lv 1 1 pt. 8,587
  8. Avatar for Mohoernchen 48. Mohoernchen Lv 1 1 pt. 8,582
  9. Avatar for kitsoune 49. kitsoune Lv 1 1 pt. 8,519
  10. Avatar for DScott 50. DScott Lv 1 1 pt. 8,508

Comments