Placeholder image of a protein
Icon representing a puzzle

2593: Electron Density Reconstruction 113

Closed since 12 months ago

Novice Overall Prediction Electron Density

Summary

Created
March 25, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
FPTIPLSRLFQNAMLRAHRLHQLAFDTYEEFEEAYIPKEQKYSFLQAPQASLCFSESIPTPSNREQAQQKSNLQLLRISLLLIQSWLEPVGFLRSVFANSLVYGASDSDVYDLLKDLEEGIQTLMGRLEDGSPRTGQAFKQTYAKFDANSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 19,658
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 17,817
  1. Avatar for Bruno Kestemont 11. Bruno Kestemont Lv 1 46 pts. 21,349
  2. Avatar for BootsMcGraw 12. BootsMcGraw Lv 1 42 pts. 21,292
  3. Avatar for nicobul 13. nicobul Lv 1 38 pts. 21,270
  4. Avatar for SemperRabbit 14. SemperRabbit Lv 1 35 pts. 21,227
  5. Avatar for AlkiP0Ps 15. AlkiP0Ps Lv 1 32 pts. 21,188
  6. Avatar for akaaka 16. akaaka Lv 1 29 pts. 21,131
  7. Avatar for BarrySampson 17. BarrySampson Lv 1 27 pts. 21,029
  8. Avatar for TheGUmmer 18. TheGUmmer Lv 1 24 pts. 20,996
  9. Avatar for bravosk8erboy 19. bravosk8erboy Lv 1 22 pts. 20,980
  10. Avatar for alcor29 20. alcor29 Lv 1 20 pts. 20,967

Comments