Icon representing a puzzle

2595: Revisiting Puzzle 113: White Birch

Closed since 11 months ago

Novice Overall Prediction

Summary

Created
April 09, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 9,093
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 8,815
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 5,520
  4. Avatar for Boilermakers 14. Boilermakers 1 pt. 5,520
  1. Avatar for Dr.Sillem 31. Dr.Sillem Lv 1 10 pts. 10,492
  2. Avatar for Anfinsen_slept_here 32. Anfinsen_slept_here Lv 1 9 pts. 10,471
  3. Avatar for Superphosphate 33. Superphosphate Lv 1 9 pts. 10,469
  4. Avatar for manu8170 34. manu8170 Lv 1 8 pts. 10,356
  5. Avatar for WBarme1234 35. WBarme1234 Lv 1 7 pts. 10,352
  6. Avatar for Joanna_H 36. Joanna_H Lv 1 6 pts. 10,283
  7. Avatar for Vinara 37. Vinara Lv 1 6 pts. 10,273
  8. Avatar for heather-1 38. heather-1 Lv 1 5 pts. 10,241
  9. Avatar for Greg60 39. Greg60 Lv 1 5 pts. 10,188
  10. Avatar for rosie4loop 40. rosie4loop Lv 1 4 pts. 10,142

Comments