Icon representing a puzzle

2595: Revisiting Puzzle 113: White Birch

Closed since 11 months ago

Novice Overall Prediction

Summary

Created
April 09, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 9,093
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 8,815
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 5,520
  4. Avatar for Boilermakers 14. Boilermakers 1 pt. 5,520
  1. Avatar for Hellcat6 41. Hellcat6 Lv 1 4 pts. 10,135
  2. Avatar for Simek 42. Simek Lv 1 3 pts. 10,091
  3. Avatar for zbp 43. zbp Lv 1 3 pts. 10,088
  4. Avatar for Floddi 44. Floddi Lv 1 3 pts. 10,057
  5. Avatar for abiogenesis 45. abiogenesis Lv 1 2 pts. 10,052
  6. Avatar for ppp6 46. ppp6 Lv 1 2 pts. 10,046
  7. Avatar for carxo 47. carxo Lv 1 2 pts. 10,028
  8. Avatar for toshiue 48. toshiue Lv 1 2 pts. 10,020
  9. Avatar for Larini 49. Larini Lv 1 2 pts. 9,914
  10. Avatar for bestfolder29zb 50. bestfolder29zb Lv 1 1 pt. 9,888

Comments