Icon representing a puzzle

2595: Revisiting Puzzle 113: White Birch

Closed since about 1 year ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 09, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Team China 11. Team China 1 pt. 9,093
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 8,815
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 5,520
  4. Avatar for Boilermakers 14. Boilermakers 1 pt. 5,520

  1. Avatar for Mohoernchen 51. Mohoernchen Lv 1 1 pt. 9,876
  2. Avatar for pizpot 52. pizpot Lv 1 1 pt. 9,844
  3. Avatar for Merf 53. Merf Lv 1 1 pt. 9,799
  4. Avatar for RWoodcock 54. RWoodcock Lv 1 1 pt. 9,754
  5. Avatar for Fasodankfds 55. Fasodankfds Lv 1 1 pt. 9,754
  6. Avatar for Trajan464 56. Trajan464 Lv 1 1 pt. 9,738
  7. Avatar for DScott 57. DScott Lv 1 1 pt. 9,672
  8. Avatar for kitsoune 58. kitsoune Lv 1 1 pt. 9,599
  9. Avatar for rinze 59. rinze Lv 1 1 pt. 9,557
  10. Avatar for DH160 60. DH160 Lv 1 1 pt. 9,538

Comments