Icon representing a puzzle

2595: Revisiting Puzzle 113: White Birch

Closed since about 1 year ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 09, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Team China 11. Team China 1 pt. 9,093
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 8,815
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 5,520
  4. Avatar for Boilermakers 14. Boilermakers 1 pt. 5,520

  1. Avatar for furi0us 71. furi0us Lv 1 1 pt. 9,077
  2. Avatar for HighlandChemists 72. HighlandChemists Lv 1 1 pt. 9,072
  3. Avatar for marxuletas 73. marxuletas Lv 1 1 pt. 9,024
  4. Avatar for Iansun 74. Iansun Lv 1 1 pt. 8,815
  5. Avatar for CassowaryDyke 75. CassowaryDyke Lv 1 1 pt. 8,810
  6. Avatar for CJen 76. CJen Lv 1 1 pt. 8,614
  7. Avatar for Bernardthefolder 77. Bernardthefolder Lv 1 1 pt. 8,606
  8. Avatar for Oberlech 79. Oberlech Lv 1 1 pt. 8,274
  9. Avatar for rmoretti 80. rmoretti Lv 1 1 pt. 5,520

Comments