Icon representing a puzzle

2595: Revisiting Puzzle 113: White Birch

Closed since 11 months ago

Novice Overall Prediction

Summary

Created
April 09, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,956
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 10,941
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 10,775
  4. Avatar for Void Crushers 4. Void Crushers 27 pts. 10,730
  5. Avatar for Contenders 5. Contenders 16 pts. 10,704
  6. Avatar for VeFold 6. VeFold 9 pts. 10,700
  7. Avatar for Marvin's bunch 7. Marvin's bunch 5 pts. 10,643
  8. Avatar for Australia 8. Australia 3 pts. 10,621
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 10,469
  10. Avatar for FamilyBarmettler 10. FamilyBarmettler 1 pt. 10,352
  1. Avatar for alcor29 11. alcor29 Lv 1 52 pts. 10,734
  2. Avatar for TheGUmmer 12. TheGUmmer Lv 1 49 pts. 10,730
  3. Avatar for BootsMcGraw 13. BootsMcGraw Lv 1 45 pts. 10,704
  4. Avatar for BarrySampson 14. BarrySampson Lv 1 42 pts. 10,700
  5. Avatar for akaaka 15. akaaka Lv 1 39 pts. 10,682
  6. Avatar for orily1337 16. orily1337 Lv 1 36 pts. 10,643
  7. Avatar for NinjaGreg 17. NinjaGreg Lv 1 34 pts. 10,642
  8. Avatar for grogar7 18. grogar7 Lv 1 31 pts. 10,640
  9. Avatar for AlkiP0Ps 19. AlkiP0Ps Lv 1 29 pts. 10,621
  10. Avatar for Aubade01 20. Aubade01 Lv 1 27 pts. 10,612

Comments