Icon representing a puzzle

2595: Revisiting Puzzle 113: White Birch

Closed since about 1 year ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 09, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Go Science 100 pts. 10,956
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 10,941
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 10,775
  4. Avatar for Void Crushers 4. Void Crushers 27 pts. 10,730
  5. Avatar for Contenders 5. Contenders 16 pts. 10,704
  6. Avatar for VeFold 6. VeFold 9 pts. 10,700
  7. Avatar for Marvin's bunch 7. Marvin's bunch 5 pts. 10,643
  8. Avatar for Australia 8. Australia 3 pts. 10,621
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 10,469
  10. Avatar for FamilyBarmettler 10. FamilyBarmettler 1 pt. 10,352

  1. Avatar for AlphaFold2 21. AlphaFold2 Lv 1 25 pts. 10,591
  2. Avatar for jausmh 22. jausmh Lv 1 23 pts. 10,587
  3. Avatar for nicobul 23. nicobul Lv 1 21 pts. 10,587
  4. Avatar for meatexplosion 24. meatexplosion Lv 1 19 pts. 10,576
  5. Avatar for LHOr 25. LHOr Lv 1 18 pts. 10,573
  6. Avatar for drumpeter18yrs9yrs 26. drumpeter18yrs9yrs Lv 1 16 pts. 10,561
  7. Avatar for amakedon 27. amakedon Lv 1 15 pts. 10,551
  8. Avatar for gmn 28. gmn Lv 1 14 pts. 10,542
  9. Avatar for jamiexq 29. jamiexq Lv 1 12 pts. 10,520
  10. Avatar for JuliaBCollet 30. JuliaBCollet Lv 1 11 pts. 10,497

Comments