Icon representing a puzzle

2595: Revisiting Puzzle 113: White Birch

Closed since 11 months ago

Novice Overall Prediction

Summary

Created
April 09, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,956
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 10,941
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 10,775
  4. Avatar for Void Crushers 4. Void Crushers 27 pts. 10,730
  5. Avatar for Contenders 5. Contenders 16 pts. 10,704
  6. Avatar for VeFold 6. VeFold 9 pts. 10,700
  7. Avatar for Marvin's bunch 7. Marvin's bunch 5 pts. 10,643
  8. Avatar for Australia 8. Australia 3 pts. 10,621
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 10,469
  10. Avatar for FamilyBarmettler 10. FamilyBarmettler 1 pt. 10,352
  1. Avatar for thankyou 61. thankyou Lv 1 1 pt. 9,523
  2. Avatar for NPrincipi 62. NPrincipi Lv 1 1 pt. 9,498
  3. Avatar for HY_Li360 63. HY_Li360 Lv 1 1 pt. 9,413
  4. Avatar for ameliagrace 64. ameliagrace Lv 1 1 pt. 9,266
  5. Avatar for erinaboss 65. erinaboss Lv 1 1 pt. 9,241
  6. Avatar for efull 66. efull Lv 1 1 pt. 9,185
  7. Avatar for glaminator 67. glaminator Lv 1 1 pt. 9,166
  8. Avatar for ABC 68. ABC Lv 1 1 pt. 9,107
  9. Avatar for prkfour 69. prkfour Lv 1 1 pt. 9,106
  10. Avatar for Rodor2016 70. Rodor2016 Lv 1 1 pt. 9,093

Comments