Placeholder image of a protein
Icon representing a puzzle

2601: Electron Density Reconstruction 115

Closed since 11 months ago

Novice Overall Prediction Electron Density

Summary

Created
April 09, 2025
Expires
Max points
100
Description

The structure of this protein and bound DNA has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
TGTTTTTGAGAAGA ATCTTCTCAAAAAC GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKKRMN

Top groups

  1. Avatar for L'Alliance Francophone
    1. L'Alliance Francophone
    100 pts. 19,917
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 56 pts. 19,909
  3. Avatar for Go Science 3. Go Science 29 pts. 19,872
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 14 pts. 19,872
  5. Avatar for Gargleblasters 5. Gargleblasters 6 pts. 19,842
  6. Avatar for Marvin's bunch 6. Marvin's bunch 2 pts. 19,805
  7. Avatar for Australia 7. Australia 1 pt. 19,780
  8. Avatar for Contenders 8. Contenders 1 pt. 19,776
  9. Avatar for VeFold 9. VeFold 1 pt. 19,774
  10. Avatar for Intellectual decay of Brazil (IDEB) 10. Intellectual decay of Brazil (IDEB) 1 pt. 14,941
  1. Avatar for meatexplosion 11. meatexplosion Lv 1 47 pts. 19,797
  2. Avatar for Punzi Baker 3 12. Punzi Baker 3 Lv 1 43 pts. 19,795
  3. Avatar for akaaka 13. akaaka Lv 1 40 pts. 19,783
  4. Avatar for AlkiP0Ps 14. AlkiP0Ps Lv 1 36 pts. 19,780
  5. Avatar for Bletchley Park 15. Bletchley Park Lv 1 33 pts. 19,776
  6. Avatar for BarrySampson 16. BarrySampson Lv 1 30 pts. 19,774
  7. Avatar for dcrwheeler 17. dcrwheeler Lv 1 28 pts. 19,773
  8. Avatar for Aubade01 18. Aubade01 Lv 1 25 pts. 19,766
  9. Avatar for Bruno Kestemont 19. Bruno Kestemont Lv 1 23 pts. 19,765
  10. Avatar for nicobul 20. nicobul Lv 1 21 pts. 19,759

Comments