Placeholder image of a protein
Icon representing a puzzle

2601: Electron Density Reconstruction 115

Closed since 11 months ago

Novice Overall Prediction Electron Density

Summary

Created
April 09, 2025
Expires
Max points
100
Description

The structure of this protein and bound DNA has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
TGTTTTTGAGAAGA ATCTTCTCAAAAAC GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKKRMN

Top groups

  1. Avatar for L'Alliance Francophone
    1. L'Alliance Francophone
    100 pts. 19,917
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 56 pts. 19,909
  3. Avatar for Go Science 3. Go Science 29 pts. 19,872
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 14 pts. 19,872
  5. Avatar for Gargleblasters 5. Gargleblasters 6 pts. 19,842
  6. Avatar for Marvin's bunch 6. Marvin's bunch 2 pts. 19,805
  7. Avatar for Australia 7. Australia 1 pt. 19,780
  8. Avatar for Contenders 8. Contenders 1 pt. 19,776
  9. Avatar for VeFold 9. VeFold 1 pt. 19,774
  10. Avatar for Intellectual decay of Brazil (IDEB) 10. Intellectual decay of Brazil (IDEB) 1 pt. 14,941
  1. Avatar for Hellcat6 51. Hellcat6 Lv 1 1 pt. 19,065
  2. Avatar for zbp 52. zbp Lv 1 1 pt. 19,058
  3. Avatar for toshiue 53. toshiue Lv 1 1 pt. 18,957
  4. Avatar for Mohoernchen 54. Mohoernchen Lv 1 1 pt. 18,921
  5. Avatar for Merf 55. Merf Lv 1 1 pt. 18,906
  6. Avatar for chelseahexxx 56. chelseahexxx Lv 1 1 pt. 18,860
  7. Avatar for DScott 57. DScott Lv 1 1 pt. 18,839
  8. Avatar for efull 58. efull Lv 1 1 pt. 18,784
  9. Avatar for RWoodcock 59. RWoodcock Lv 1 1 pt. 18,779
  10. Avatar for Fasodankfds 60. Fasodankfds Lv 1 1 pt. 18,721

Comments